PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_1DB727AD1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 195aa    MW: 22112.2 Da    PI: 10.8945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_1DB727AD1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.7e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg W++eEde+l + v+q+G g+W+++a+  g+ R++k+c++rw +yl
  Traes_2BS_1DB727AD1.1 14 RGLWSPEEDEKLMNHVAQYGYGCWSSVAKIAGLERCGKSCRLRWMNYL 61
                           788*******************************************97 PP

2Myb_DNA-binding46.21e-1467110247
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            g++++eE++ +++++   G++ W+ Ia++++ gRt++++k++w+++
  Traes_2BS_1DB727AD1.1  67 GAFSQEEEDFIIHLHSIRGNK-WSQIAAHLP-GRTDNEVKNFWNSF 110
                            78*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-21862IPR009057Homeodomain-like
PROSITE profilePS5129424.069965IPR017930Myb domain
SuperFamilySSF466892.95E-3011107IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-161461IPR001005SANT/Myb domain
CDDcd001677.26E-121761No hitNo description
SMARTSM007177.6E-1365113IPR001005SANT/Myb domain
PROSITE profilePS5129418.70666115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-1966115IPR009057Homeodomain-like
PfamPF002492.5E-1367109IPR001005SANT/Myb domain
CDDcd001671.26E-968111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MSKWPGATKK RLKRGLWSPE EDEKLMNHVA QYGYGCWSSV AKIAGLERCG KSCRLRWMNY  60
LTTGRGGAFS QEEEDFIIHL HSIRGNKWSQ IAAHLPGRTD NEVKNFWNSF IKKKLRQRGI  120
DPATHEHKPL DPAAPAAPAT PVSRNAVFSE NELILSSPVG GPHMPPLVSA ESYVYSRGQH  180
GRRRRCARRG RRVQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-24311516128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3537850.0AK353785.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002L23.
GenBankAK3582100.0AK358210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1071D01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.18e-82PREDICTED: myb-related protein Zm1-like
SwissprotQ8LPH61e-57MYB86_ARATH; Transcription factor MYB86
TrEMBLW5BIP61e-145W5BIP6_WHEAT; Uncharacterized protein
STRINGSi029872m5e-80(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.39e-60myb domain protein 55
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]